PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589173.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 841aa    MW: 95206.7 Da    PI: 5.5678
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589173.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK506e-16652696448
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      is ++l+++F +++ dAAk+Lgv  ++LKr CR y I RWP+ k
  XP_009589173.1 652 GISRSVLEEQFGKKLSDAAKSLGVARSTLKRMCRDYDIYRWPRSK 696
                     6999**************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.843637722IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.7E-4638688IPR009057Homeodomain-like
PfamPF020424.3E-13653696IPR003035RWP-RK domain
SuperFamilySSF542777.2E-17754839No hitNo description
PROSITE profilePS5174518.234757841IPR000270PB1 domain
SMARTSM006662.4E-15757840IPR000270PB1 domain
PfamPF005647.8E-15758839IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.8E-15759838No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MPIELKFSYR KRGDGINRWV FWTQHNGDEL NQVKSLFPVL RGYEFEPWKQ PPVEMQGDST  60
QPDTNGDSQL NRLTIKNLVE LLDVQGTCLI QFWAPIRINS GKTFLTTADQ PFAFNGKIHE  120
GLWAYRRVSL LTIASVDSTE IDETKRVHVH GRPARVFRSG MPEFSPHVRY YYMDEYPLRN  180
FAMCLGVGSY WTLPVFESSG DRCIGVLEYA FEANVGLDLY STLDCLINNH RILKTMGLAL  240
IPSWLACSQE IQEVWEQELA KVKEALEVTC KTHRLLFAQT WISVLDSSRT QMLITSPPTK  300
YWSEEITSLE FLAVSDLHHV RIGQGLVGKV LSSKGSCFCR DITQLSIDFY PFVPIARCAG  360
FTACFAIFVR LNSACHMVLE FFLPNDETLD RNPQSFLSKL LATIREQLPS FFLDSGPSLF  420
VEVIRTAPVD ELDSFEISQL QQGVRSKGNE KMVLFDSLNQ DSADLGPSSS TDIGAHHMEI  480
AKDTPDNGEE TVLPDSAHKQ GVEEADAMDK EKSSVDFILA TSFAVSEKKL QQNLSTDKAS  540
LDEKLDSFEI GHRQLPSMVQ YDTINQIFGF DPSSSSDLEE IITADYGRDT QLNLQSKKRG  600
ESTQPDLAHQ QRVEEADVGD KRRHSVHVEE NANSHNCPEK HKRIKRIEKE YGISRSVLEE  660
QFGKKLSDAA KSLGVARSTL KRMCRDYDIY RWPRSKSAND VCSLSENKPV KRVENQTGNS  720
SREDLQLPHA GLSNGMDTTT TLTQRKKPTA TFQSDNAMSV KVTYKDVTIR FPFSLSSGKI  780
DLETEVEKRL KLVLIGSYSI KYEDEDNDWI AITCDSDLEY GMHTLRSLGR TTMKMLVEPL  840
N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589173.10.0PREDICTED: protein NLP7-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13981711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.13e-41NIN like protein 7